ITGA8 monoclonal antibody (M02), clone 2G7

Product Sizes

100 ug

£333.00

H00008516-M02-100UG

About this Product

SKU:: H00008516-M02
Application:: ELISA, Western Blot
translate.label.attr.clone:: 2G7
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant ITGA8.
Host:: Mouse
Immunogen:: ITGA8 (NP_003629, 836 a.a. ~ 935 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human
Sequence:: SDTILEVGWPFSARDEFLLYIFHIQTLGPLQCQPNPNINPQDIKPAASPEDTPELSAFLRNSTIPHLVRKRDVHVVEFHRQSPAKILNCTNIECLQISCA
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket