PPM1D monoclonal antibody (M01), clone 4D1

Product Sizes

100 ug

£333.00

H00008493-M01-100UG

About this Product

SKU:: H00008493-M01
Application:: ELISA, Western Blot
translate.label.attr.clone:: 4D1
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant PPM1D.
Host:: Mouse
Immunogen:: PPM1D (NP_003611, 496 a.a. ~ 605 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: IGLVPTNSTNTVMDQKNLKMSTPGQMKAQEIERTPPTNFKRTLEESNSGPLMKKHRRNGLSRSSGAQPASLPTTSQRKNSVKLTMRRRLRGQKKIGNPLLHQHRKTVCVC
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket