TTF2 monoclonal antibody (M12), clone 2B6

Product Sizes

100 ug

£333.00

H00008458-M12-100UG

About this Product

SKU:: H00008458-M12
Application:: ELISA, Western Blot
translate.label.attr.clone:: 2B6
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant TTF2.
Host:: Mouse
Immunogen:: TTF2 (NP_003585, 385 a.a. ~ 509 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: QFPDRSVQRKVSPASGVSKKVEPSDPVARRVYLTTQLKQKKSTLASVNIQALPDKGQKLIKQIQELEEVLSGLTLSPEQGTNEKSNSQVPQQSHFTKTTTGPPHLVPPQPLPRRGTQPVGSLELK
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket