HIST2H2AA monoclonal antibody (M01), clone 4C10

Product Sizes

100 ug

£333.00

H00008337-M01-100UG

About this Product

SKU:: H00008337-M01
Application:: ELISA, Immunofluorescence, Western Blot
translate.label.attr.clone:: 4C10
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant HIST2H2AA.
Host:: Mouse
Immunogen:: HIST2H2AA (AAH01629, 1 a.a. ~ 130 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket