EOMES monoclonal antibody (M14), clone 2D3

Product Sizes

100 ug

£333.00

H00008320-M14-100UG

About this Product

SKU:: H00008320-M14
Application:: ELISA, Western Blot
translate.label.attr.clone:: 2D3
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant EOMES.
Host:: Mouse
Immunogen:: EOMES (NP_005433.2, 461 a.a. ~ 569 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human, Rat
Sequence:: SHQIVPGGRYGVQSFFPEPFVNTLPQARYYNGERTVPQTNGLLSPQQSEEVANPPQRWLVTPVQQPGTNKLDISSYESEYTSSTLLPYGIKSLPLQTSHALGYYPDPTF
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket