PAX8 monoclonal antibody (M17), clone 1D1

Product Sizes

100 ug

£333.00

H00007849-M17-100UG

About this Product

SKU:: H00007849-M17
Application:: ELISA, Western Blot
translate.label.attr.clone:: 1D1
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant PAX8.
Host:: Mouse
Immunogen:: PAX8 (NP_003457, 199 a.a. ~ 313 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human
Sequence:: DDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVADPHSPFAIKQETPE
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket