CLIP2 monoclonal antibody (M07), clone 3H5

Product Sizes

100 ug

£333.00

H00007461-M07-100UG

About this Product

SKU:: H00007461-M07
Application:: ELISA, Western Blot
translate.label.attr.clone:: 3H5
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant CLIP2.
Host:: Mouse
Immunogen:: CLIP2 (NP_003379, 946 a.a. ~ 1046 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: LKDDIRGLREKLTGLDKEKSLSDQRRYSLIDRSSAPELLRLQHQLMSTEDALRDALDQAQQVEKLMEAMRSCPDKAQTIGNSGSANGIHQQDKAQKQEDKH
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket