TWIST1 monoclonal antibody (M13), clone 2G12
Product Sizes
100 ug
£333.00
H00007291-M13-100UG
About this Product
- SKU:
- H00007291-M13
- Application:
- ELISA, Immunoprecipitation, Western Blot
- translate.label.attr.clone:
- 2G12
- Clonality:
- Monoclonal
- Extra Details:
- Mouse monoclonal antibody raised against a full length recombinant TWIST1.
- Host:
- Mouse
- Immunogen:
- TWIST1 (NP_000465.1, 106 a.a. ~ 174 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotype:
- IgG2a, kappa
- Reactivities:
- Human
- Sequence:
- LQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMAS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Abnova
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:H00007291-M13
