TRIP6 monoclonal antibody (M04), clone 4B7

Product Sizes

100 ug

£333.00

H00007205-M04-100UG

About this Product

SKU:: H00007205-M04
Application:: ELISA, Immunofluorescence, Western Blot
translate.label.attr.clone:: 4B7
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant TRIP6.
Host:: Mouse
Immunogen:: TRIP6 (NP_003293, 51 a.a. ~ 148 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG3, kappa
Reactivities:: Human
Sequence:: SEQCYQAPGGPEDRGPAWVGSHGVLQHTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDRQAYEPPPPPAYRTGSLKPNPASPLPASP
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket