STX4A monoclonal antibody (M02), clone 6A1

Product Sizes

100 ug

£333.00

H00006810-M02-100UG

About this Product

SKU:: H00006810-M02
Application:: ELISA, Immunofluorescence, Western Blot
translate.label.attr.clone:: 6A1
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant STX4A.
Host:: Mouse
Immunogen:: STX4A (NP_004595, 19 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human, Mouse
Sequence:: DKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVN
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket