SPTBN2 monoclonal antibody (M06), clone 4D9

Product Sizes

100 ug

£333.00

H00006712-M06-100UG

About this Product

SKU:: H00006712-M06
Application:: ELISA, Western Blot
translate.label.attr.clone:: 4D9
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant SPTBN2.
Host:: Mouse
Immunogen:: SPTBN2 (NP_008877, 643 a.a. ~ 720 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG3, kappa
Reactivities:: Human
Sequence:: LWRFLWEVGEAEAWVREQQHLLASADTGRDLTGALRLLNKHTALRGEMSGRLGPLKLTLEQGQQLVAEGHPGASQASA
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket