SPP1 monoclonal antibody (M14), clone 1A7

Product Sizes

100 ug

£333.00

H00006696-M14-100UG

About this Product

SKU:: H00006696-M14
Application:: ELISA, Western Blot
translate.label.attr.clone:: 1A7
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant SPP1.
Host:: Mouse
Immunogen:: SPP1 (NP_000573.1, 21 a.a. ~ 129 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human
Sequence:: QADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQTLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPAT
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket