SIAH1 monoclonal antibody (M05), clone 2F26

Product Sizes

100 ug

£333.00

H00006477-M05-100UG

About this Product

SKU:: H00006477-M05
Application:: ELISA, Western Blot
translate.label.attr.clone:: 2F26
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant SIAH1.
Host:: Mouse
Immunogen:: SIAH1 (NP_003022, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgM, kappa
Reactivities:: Human
Sequence:: MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLP
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket