CXCL12 monoclonal antibody (M01), clone 1E5

Product Sizes

100 ug

£333.00

H00006387-M01-100UG

About this Product

SKU:: H00006387-M01
Application:: ELISA
translate.label.attr.clone:: 1E5
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant CXCL12.
Host:: Mouse
Immunogen:: CXCL12 (AAH39893.1, 1 a.a. ~ 89 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human
Sequence:: MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket