SCNN1D monoclonal antibody (M02), clone 2F3
Product Sizes
100 ug
£333.00
H00006339-M02-100UG
About this Product
- SKU:
- H00006339-M02
- Application:
- ELISA
- translate.label.attr.clone:
- 2F3
- Clonality:
- Monoclonal
- Extra Details:
- Mouse monoclonal antibody raised against a partial recombinant SCNN1D.
- Host:
- Mouse
- Immunogen:
- SCNN1D (NP_002969, 432 a.a. ~ 530 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotype:
- IgG2a, kappa
- Reactivities:
- Human
- Sequence:
- CFYRLYQDLETHRLPCTSRCPRPCRESAFKLSTGTSRWPSAKSAGWTLATLGEQGLPHQSHRQRSSLAKINIVYQELNYRSVEEAPVYSVPQLLSAMGS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Abnova
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:H00006339-M02
