S100A9 monoclonal antibody (M01A), clone 1C10
Product Sizes
200 ul
£333.00
H00006280-M01A-200UL
About this Product
- SKU:
- H00006280-M01A
- Application:
- ELISA, Western Blot
- translate.label.attr.clone:
- 1C10
- Clonality:
- Monoclonal
- Extra Details:
- Mouse monoclonal antibody raised against a full length recombinant S100A9.
- Host:
- Mouse
- Immunogen:
- S100A9 (AAH47681, 1 a.a. ~ 114 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotype:
- IgG
- Reactivities:
- Human
- Sequence:
- MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENRNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Abnova
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:H00006280-M01A
