RXRA monoclonal antibody (M34J), clone 3F5

Product Sizes

100 ug

£494.00

H00006256-M34J-100UG

About this Product

SKU:: H00006256-M34J
Additional Names:: CXGrade
Application:: ELISA
translate.label.attr.clone:: 3F5
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant RXRA. This product is belong to Cell Culture Grade Antibody (CX Grade).
Host:: Mouse
Immunogen:: RXRA (NP_002948.1, 27 a.a. ~ 94 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: SMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQL
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket