RPS7 monoclonal antibody (M03), clone 3G4

Product Sizes

100 ug

£333.00

H00006201-M03-100UG

About this Product

SKU:: H00006201-M03
Application:: ELISA, IHC-Paraffin, Immunofluorescence, Western Blot
translate.label.attr.clone:: 3G4
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant RPS7.
Host:: Mouse
Immunogen:: RPS7 (NP_001002, 95 a.a. ~ 194 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human, Mouse, Rat
Sequence:: IAQRRILPKPTRKSRTKNKQKRPRSRTLTAVHDAILEDLVFPSEIVGKRIRVKLDGSRLIKVHLDKAQQNNVEHKVETFSGVYKKLTGKDVNFEFPEFQL
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket