RPS6KB1 monoclonal antibody (M04), clone 4H4

Product Sizes

100 ug

£333.00

H00006198-M04-100UG

About this Product

SKU:: H00006198-M04
Application:: ELISA, Immunofluorescence, Western Blot
translate.label.attr.clone:: 4H4
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant RPS6KB1.
Host:: Mouse
Immunogen:: RPS6KB1 (NP_003152, 416 a.a. ~ 525 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human, Mouse, Rat
Sequence:: PSVLESVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket