RLF monoclonal antibody (M05), clone 2G2

Product Sizes

100 ug

£333.00

H00006018-M05-100UG

About this Product

SKU:: H00006018-M05
Application:: ELISA, Western Blot
translate.label.attr.clone:: 2G2
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant RLF.
Host:: Mouse
Immunogen:: RLF (NP_036553.1, 1805 a.a. ~ 1913 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: SNDLTGNVVANNMVNDSEPEVDIPHSSSDSTIHENLTAIPPLIVAETTTVPSLENLRVVLDKALTDCGELALKQLHYLRPVVVLERSKFSTPILDLFPTKKTDELCVGS
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket