RAD23B monoclonal antibody (M10), clone 3H7

Product Sizes

100 ug

£333.00

H00005887-M10-100UG

About this Product

SKU:: H00005887-M10
Application:: ELISA, IHC-Paraffin, Western Blot
translate.label.attr.clone:: 3H7
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant RAD23B.
Host:: Mouse
Immunogen:: RAD23B (NP_002865.1, 311 a.a. ~ 409 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human
Sequence:: PQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket