RAB5A monoclonal antibody (M09A), clone 5D1

Product Sizes

200 ul

£333.00

H00005868-M09A-200UL

About this Product

SKU:: H00005868-M09A
Application:: ELISA, Western Blot
translate.label.attr.clone:: 5D1
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant RAB5A.
Host:: Mouse
Immunogen:: RAB5A (AAH01267, 116 a.a. ~ 215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgM, kappa
Reactivities:: Human, Mouse
Sequence:: KELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket