QARS monoclonal antibody (M01), clone 5F5

Product Sizes

100 ug

£333.00

H00005859-M01-100UG

About this Product

SKU:: H00005859-M01
Application:: ELISA, IHC-Paraffin, Immunoprecipitation, Western Blot
translate.label.attr.clone:: 5F5
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant QARS.
Host:: Mouse
Immunogen:: QARS (NP_005042, 677 a.a. ~ 775 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human
Sequence:: FIHWVSQPLMCEVRLYERLFQHKNPEDPTEVPGGFLSDLNLASLHVVDAALVDCSVALAKPFDKFQFERLGYFSVDPDSHQGKLVFNRTVTLKEDPGKV
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket