PURA monoclonal antibody (M07), clone 1D6

Product Sizes

100 ug

£333.00

H00005813-M07-100UG

About this Product

SKU:: H00005813-M07
Application:: ELISA, Immunofluorescence, Western Blot
translate.label.attr.clone:: 1D6
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant PURA.
Host:: Mouse
Immunogen:: PURA (NP_005850, 183 a.a. ~ 292 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human
Sequence:: TQGQTIALPAQGLIEFRDALAKLIDDYGVEEEPAELPEGTSLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPYKVWAKFGHTFCKYSEETKKIQEKQREKRAAC
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket