PTPRE monoclonal antibody (M04), clone 2D10

Product Sizes

100 ug

£333.00

H00005791-M04-100UG

About this Product

SKU:: H00005791-M04
Application:: ELISA, Immunofluorescence
translate.label.attr.clone:: 2D10
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant PTPRE.
Host:: Mouse
Immunogen:: PTPRE (AAH50062, 511 a.a. ~ 600 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: WRMIWEWKSHTIVMLTEVQEREQDKCYQYWPTEGSVTHGEITIEIKNDTLSEAISIRDFLVTLNQPQARQEEQVRVVRQFHFHGWPEIGI
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket