PSMD10 monoclonal antibody (M22), clone 1B4

Product Sizes

100 ug

£333.00

H00005716-M22-100UG

About this Product

SKU:: H00005716-M22
Application:: ELISA, Western Blot
translate.label.attr.clone:: 1B4
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant PSMD10.
Host:: Mouse
Immunogen:: PSMD10 (AAH11960, 127 a.a. ~ 226 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: EGGANPDAKDHYEATAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVSQGASIYIENKEEKTPLQVAKGGLGLILKRMVEG
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket