MAP2K3 monoclonal antibody (M01A), clone 2F12

Product Sizes

200 ul

£333.00

H00005606-M01A-200UL

About this Product

SKU:: H00005606-M01A
Application:: ELISA, Western Blot
translate.label.attr.clone:: 2F12
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant MAP2K3.
Host:: Mouse
Immunogen:: MAP2K3 (AAH32478, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVN
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket