PPARBP monoclonal antibody (M05), clone 2H6

Product Sizes

100 ug

£333.00

H00005469-M05-100UG

About this Product

SKU:: H00005469-M05
Application:: ELISA, Western Blot
translate.label.attr.clone:: 2H6
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant PPARBP.
Host:: Mouse
Immunogen:: PPARBP (NP_004765, 1391 a.a. ~ 1490 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: KIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSKNYGSPLISGSTPKHERGSPSHSKSPAYTPQNLDSESESGSSIAEKSYQNSPSSDDGIRPLP
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket