POLR2A monoclonal antibody (M02), clone 1F17

Product Sizes

100 ug

£333.00

H00005430-M02-100UG

About this Product

SKU:: H00005430-M02
Application:: ELISA, Western Blot
translate.label.attr.clone:: 1F17
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant POLR2A.
Host:: Mouse
Immunogen:: POLR2A (NP_000928, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human
Sequence:: MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCV
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket