PLD1 monoclonal antibody (M02), clone 10H2

Product Sizes

100 ug

£333.00

H00005337-M02-100UG

About this Product

SKU:: H00005337-M02
Application:: ELISA, Western Blot
translate.label.attr.clone:: 10H2
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant PLD1.
Host:: Mouse
Immunogen:: PLD1 (NP_002653, 965 a.a. ~ 1074 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: GYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFINKPVLAKEDPIRAEEELKKIRGFLVQFPFYFLSEESLLPSVGTKEAIVPMEVWT
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket