PIK4CB monoclonal antibody (M02), clone 3B1

Product Sizes

100 ug

£333.00

H00005298-M02-100UG

About this Product

SKU:: H00005298-M02
Application:: ELISA, Western Blot
translate.label.attr.clone:: 3B1
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant PIK4CB.
Host:: Mouse
Immunogen:: PIK4CB (NP_002642.1, 731 a.a. ~ 828 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human
Sequence:: GGLDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGIM
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket