PDE1B monoclonal antibody (M02), clone 4F9

Product Sizes

100 ug

£333.00

H00005153-M02-100UG

About this Product

SKU:: H00005153-M02
Application:: ELISA, Western Blot
translate.label.attr.clone:: 4F9
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant PDE1B.
Host:: Mouse
Immunogen:: PDE1B (AAH32226, 437 a.a. ~ 536 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG3, kappa
Reactivities:: Human
Sequence:: TDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFRSTWVKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket