NKX6-1 monoclonal antibody (M01), clone 1B7

Product Sizes

100 ug

£333.00

H00004825-M01-100UG

About this Product

SKU:: H00004825-M01
Application:: ELISA, Western Blot
translate.label.attr.clone:: 1B7
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant NKX6-1.
Host:: Mouse
Immunogen:: NKX6-1 (NP_006159, 191 a.a. ~ 275 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: PKPLAELPGRTPIFWPGVMQSPPWRDARLACTPHQGSILLDKDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGM*
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket