NFYC monoclonal antibody (M01A), clone 1D3

Product Sizes

200 ul

£333.00

H00004802-M01A-200UL

About this Product

SKU:: H00004802-M01A
Application:: ELISA, Western Blot
translate.label.attr.clone:: 1D3
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant NFYC.
Host:: Mouse
Immunogen:: NFYC (AAH05003.1, 14 a.a. ~ 113 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: DAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDF
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket