NDUFS4 monoclonal antibody (M02A), clone 3A4
Product Sizes
200 ul
£333.00
H00004724-M02A-200UL
About this Product
- SKU:
- H00004724-M02A
- Application:
- ELISA
- translate.label.attr.clone:
- 3A4
- Clonality:
- Monoclonal
- Extra Details:
- Mouse monoclonal antibody raised against a full-length recombinant NDUFS4.
- Host:
- Mouse
- Immunogen:
- NDUFS4 (AAH05270, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotype:
- IgM, kappa
- Reactivities:
- Human
- Sequence:
- MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSSWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Abnova
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:H00004724-M02A
