MUC7 monoclonal antibody (M06), clone 7F2

Product Sizes

50 ug

£333.00

H00004589-M06-50UG

About this Product

SKU:: H00004589-M06
Application:: ELISA, Western Blot
translate.label.attr.clone:: 7F2
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant MUC7.
Host:: Mouse
Immunogen:: MUC7 (NP_689504, 36 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: HQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQN
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket