MSX1 monoclonal antibody (M05), clone 1D2

Product Sizes

100 ug

£333.00

H00004487-M05-100UG

About this Product

SKU:: H00004487-M05
Application:: ELISA, Immunoprecipitation, Western Blot
translate.label.attr.clone:: 1D2
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant MSX1.
Host:: Mouse
Immunogen:: MSX1 (NP_002439, 216 a.a. ~ 297 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: NRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket