MAP3K5 monoclonal antibody (M02), clone 1E3

Product Sizes

100 ug

£333.00

H00004217-M02-100UG

About this Product

SKU:: H00004217-M02
Application:: ELISA, Western Blot
translate.label.attr.clone:: 1E3
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant MAP3K5.
Host:: Mouse
Immunogen:: MAP3K5 (AAH54503, 1231 a.a. ~ 1374 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human
Sequence:: SHDSQSAHRSLNVQLGRMKIETNRLLEELVRKEKELQALLHRAIEEKDQEIKHLKLKSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket