MAP3K1 monoclonal antibody (M01), clone 2F6

Product Sizes

100 ug

£333.00

H00004214-M01-100UG

About this Product

SKU:: H00004214-M01
Application:: ELISA, Proximity Ligation Assay, Western Blot
translate.label.attr.clone:: 2F6
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant MAP3K1.
Host:: Mouse
Immunogen:: MAP3K1 (XP_042066, 1211 a.a. ~ 1310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTPVEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket