MAGEB1 monoclonal antibody (M09), clone 3C1

Product Sizes

100 ug

£333.00

H00004112-M09-100UG

About this Product

SKU:: H00004112-M09
Application:: ELISA, Immunofluorescence, Western Blot
translate.label.attr.clone:: 3C1
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant MAGEB1.
Host:: Mouse
Immunogen:: MAGEB1 (NP_803134.1, 86 a.a. ~ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: QGEENASFSQATTSTESSVKDPVAWEAGMLMHFILRKYKMREPIMKADMLKVVDEKYKDHFTEILNGASRRLELVFGLDLKEDNPSGHTYTLVSKLNLTNDGNLSNDWDF
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket