MAG monoclonal antibody (M35), clone 3C7

Product Sizes

100 ug

£333.00

H00004099-M35-100UG

About this Product

SKU:: H00004099-M35
Application:: ELISA, IHC-Paraffin, Western Blot
translate.label.attr.clone:: 3C7
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant MAG.
Host:: Mouse
Immunogen:: MAG (NP_002352, 119 a.a. ~ 208 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: GDLGGYNQYTFSEHSVLDIVNTPNIVVPPEVVAGTEVEVSCMVPDNCPELRPELSWLGHEGLGEPAVLGRLREDEGTWVQVSLLHFVPTR
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket