MXD1 monoclonal antibody (M03), clone 2G10

Product Sizes

100 ug

£333.00

H00004084-M03-100UG

About this Product

SKU:: H00004084-M03
Application:: ELISA, IHC-Paraffin
translate.label.attr.clone:: 2G10
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant MXD1.
Host:: Mouse
Immunogen:: MXD1 (NP_002348.1, 60 a.a. ~ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: THNEMEKNRRAHLRLCLEKLKGLVPLGPESSRHTTLSLLTKAKLHIKKLEDCDRKAVHQIDQLQREQRHLKRQLEKLGIERIRMDSIGST
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket