LMO2 monoclonal antibody (M05J), clone 4D3

Product Sizes

100 ug

£494.00

H00004005-M05J-100UG

About this Product

SKU:: H00004005-M05J
Additional Names:: CXGrade
Application:: ELISA, Western Blot
translate.label.attr.clone:: 4D3
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant LMO2. This product is belong to Cell Culture Grade Antibody (CX Grade).
Host:: Mouse
Immunogen:: LMO2 (NP_005565, 16 a.a. ~ 102 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: PVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIR
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket