ABLIM1 monoclonal antibody (M06), clone 2C6

Product Sizes

100 ug

£333.00

H00003983-M06-100UG

About this Product

SKU:: H00003983-M06
Application:: ELISA, Western Blot
translate.label.attr.clone:: 2C6
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant ABLIM1.
Host:: Mouse
Immunogen:: ABLIM1 (NP_002304, 637 a.a. ~ 736 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: RYDSPINSASHIPSSKTASLPGYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMPAMRMDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILREVD
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket