ABLIM1 monoclonal antibody (M01C), clone 3A1

Product Sizes

200 ul

£333.00

H00003983-M01C-200UL

About this Product

SKU:: H00003983-M01C
Additional Names:: CXGrade
Application:: ELISA, Western Blot
translate.label.attr.clone:: 3A1
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant ABLIM1. This product is belong to Cell Culture Grade Antibody (CX Grade).
Host:: Mouse
Immunogen:: ABLIM1 (NP_002304, 637 a.a. ~ 736 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: RYDSPINSASHIPSSKTASLPGYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMPAMRMDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILREVD
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket