LETM1 monoclonal antibody (M03), clone 6F7

Product Sizes

100 ug

£333.00

H00003954-M03-100UG

About this Product

SKU:: H00003954-M03
Application:: ELISA, IHC-Paraffin, Immunofluorescence, Immunoprecipitation, Western Blot
translate.label.attr.clone:: 6F7
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant LETM1.
Host:: Mouse
Immunogen:: LETM1 (NP_036450, 601 a.a. ~ 708 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: ESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKLAPANGMPTGENVISVAELINAMKQVKHIPESKLTSLAAALDENKDGKVNIDDLVKVIELVDKEDVHISTSQVA
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket