KRAS monoclonal antibody (M02J), clone 4F3

Product Sizes

100 ug

£494.00

H00003845-M02J-100UG

About this Product

SKU:: H00003845-M02J
Additional Names:: CXGrade
Application:: ELISA, Western Blot
translate.label.attr.clone:: 4F3
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant KRAS. This product is belong to Cell Culture Grade Antibody (CX Grade).
Host:: Mouse
Immunogen:: KRAS (NP_004976, 16 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: KSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTV
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket