IL10 monoclonal antibody (M03A), clone 1C10

Product Sizes

200 ul

£333.00

H00003586-M03A-200UL

About this Product

SKU:: H00003586-M03A
Application:: ELISA, Western Blot
translate.label.attr.clone:: 1C10
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant IL10.
Host:: Mouse
Immunogen:: IL10 (AAI04253.1, 74 a.a. ~ 178 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG3, kappa
Reactivities:: Human
Sequence:: FKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket