IFI16 monoclonal antibody (M04), clone 4E6

Product Sizes

100 ug

£333.00

H00003428-M04-100UG

About this Product

SKU:: H00003428-M04
Application:: ELISA, IHC-Paraffin, Western Blot
translate.label.attr.clone:: 4E6
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant IFI16.
Host:: Mouse
Immunogen:: IFI16 (AAH17059, 630 a.a. ~ 729 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: FVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket