IDH2 polyclonal antibody (A01)
Product Sizes
50 ul
£222.00
H00003418-A01-50UL
About this Product
- SKU:
- H00003418-A01
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Mouse polyclonal antibody raised against a partial recombinant IDH2.
- Host:
- Mouse
- Immunogen:
- IDH2 (NP_002159, 354 a.a. ~ 451 a.a) partial recombinant protein with GST tag.
- Reactivities:
- Human
- Sequence:
- HYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGR
- Shipping Conditions:
- Blue Ice
- Specificity:
- This antibody cross-reacts with human IDH1.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Abnova
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:H00003418-A01
